2.62 Rating by CuteStat

It is a domain having com extension. It has a global traffic rank of #17886197 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, hollywoodghosthunters.com is SAFE to browse.

PageSpeed Score
57
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 27
Daily Pageviews: 54

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 17,886,197
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

97.74.144.127

Hosted Country:

United States of America US

Location Latitude:

33.6119

Location Longitude:

-111.8906
HOLLYWOOD GHOST HUNTERS - Horror Film Professionals Stalking the Supernatural

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 25
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 97.74.144.127)

Creekside of Brentwood - Index

- creeksideofbrentwood.org

Creekside of Brentwood - Index

548,824 $ 1,200.00

راه کارگر نیوز

- rahekaregarnews.com

rahekaregar, راه کارگر,culture, rahekargar, iran, , politics, politic, left, socialism, ایران , news, persian, politics, news, revolution, reform, country, Teheran, Tabriz, Karaj, mashahd, abadan, kurdistan, kurdestan, rasht, ardebil, sanandaj, baneh, rahe karegar

1,387,314 $ 480.00

My Website | Just another WordPress site

- poolcleaningservicerepairmckinney.com
Not Applicable $ 8.95

Pool Cleaning and Repair Frisco Texas | Pool Cleaning Service and Repa

- poolcleaningservicerepairfrisco.com
Not Applicable $ 8.95

F.C. Playa Vista

- fcplayavista.com

FC Playa Vista is a recrational soccer club located in Marina Del Rey, California near Playa Vista. We have just begun expanding the club and will build several teams to play throughout Los Angeles.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 22 May 2017 01:58:26 GMT
Server: Apache
Accept-Ranges: bytes
Content-Length: 10166
Content-Type: text/html

DNS Record Analysis

Host Type TTL Extra
hollywoodghosthunters.com A 599 IP: 97.74.144.127
hollywoodghosthunters.com NS 3599 Target: ns54.domaincontrol.com
hollywoodghosthunters.com NS 3599 Target: ns53.domaincontrol.com
hollywoodghosthunters.com SOA 3599 MNAME: ns53.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2016050400
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 3600
hollywoodghosthunters.com MX 3599 Priority: 10
Target: mailstore1.secureserver.net
hollywoodghosthunters.com MX 3599 Target: smtp.secureserver.net

Similarly Ranked Websites

403 Forbidden

- themivalley.com
17,886,213 $ 8.95

СБКТС | Свидетельство о безопасности конструкции транспортного средств

- bkts.pro

10 лет опыта работы в сфере оформления автомобилей. СБКТС за 1 час, ПТС на Таможне 1 день! Любая сложность оформления.+7(499) 755-60-45

17,886,230 $ 8.95

Account Suspended

- humawaztv.com
17,886,239 $ 8.95

Clint Kjar Photo

- clintkjar.com
17,886,282 $ 8.95

İnstagram Takipçi Satın Al - Sosyal Medya Hub

- sosyalmedyahub.com

Sosyal Medya Hub, düşmeyen İnstagram takipçi satın alma konusunda uzmandır. İnstagram takipçi satın al ve sosyal medyada fenomen ol!

17,886,293 $ 8.95